Structure of PDB 3hay Chain D Binding Site BS01

Receptor Information

>3hay Chain D (length=121) Species: 2261 (Pyrococcus furiosus)

KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVI
IAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAII
EPGKARDLVEEIAMKVKELMK

Ligand information

>3hay Chain E (length=69)

ggcugccuggguccgccuugagugcccgggugagaagcaugaucccgggu
aauuauggcggacccacag

........<<<<<<<<<......<<<<<<<.............>>>>>>>
......>>>>>>>>>....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3hay Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
• Resolution: 4.99 Å
• Binding residue (original residue number in PDB): K35 G36 T37 N38 E39 K42 R46 D59 I93 E94 V95 A96 A97 A98
• Binding residue (residue number reindexed from 1): K32 G33 T34 N35 E36 K39 R43 D56 I90 E91 V92 A93 A94 A95

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0004526 ribonuclease P activity
• GO:0019843 rRNA binding

Biological Process

• GO:0001682 tRNA 5'-leader removal
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0008033 tRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3hay, PDBe:3hay, PDBj:3hay
• PDBsum: 3hay
• PubMed: 19481523
• UniProt: Q8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)