Structure of PDB 3ggz Chain D Binding Site BS01

Receptor Information
>3ggz Chain D (length=188) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIPFTIKLKTCLKMCIQRLRYAQEKQQAIAKQSRRQVAQLLLTNKEQKAH
YRVETLIHDDIHIELLEILELYCELLLARVQVINDISTEEQLVKEHMDDG
INEAIRSLIYAILFVDEVKELSQLKDLMAWKINVEFVNGVIADHIDVPEK
IIKKCSPSVPKEELVDLYLKEIAKTYDVPYSKLENSLS
Ligand information
>3ggz Chain H (length=18) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VDDEKEDKLAQRLRALRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ggz Structural basis of Ist1 function and Ist1-Did2 interaction in the multivesicular body pathway and cytokinesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K35 R38 R39 I65 E68 L171 Y172 E175 K178 Y180
Binding residue
(residue number reindexed from 1)		K31 R34 R35 I61 E64 L167 Y168 E171 K174 Y176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport

View graph for
Biological Process
External links
PDB RCSB:3ggz, PDBe:3ggz, PDBj:3ggz
PDBsum3ggz
PubMed19477918
UniProtP53843|IST1_YEAST Vacuolar protein sorting-associated protein IST1 (Gene Name=IST1)

[Back to BioLiP]