Structure of PDB 3ggw Chain D Binding Site BS01

Receptor Information

>3ggw Chain D (length=209) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVKVEESGGGLVQPGGSMKISCVVSGLTFSNYWMSWVRQSPEKGLEWVAE
IRLKSDNYATYYAESVKGKFTISRDDSKSRLYLQMNNLRTEDTGIYYCFL
PMDYWGQGTSVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASST
KVDKKIVPR

Ligand information

>3ggw Chain F (length=12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YLEDWIKYNNQK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ggw Structural Mimicry of O-Antigen by a Peptide Revealed in a Complex with an Antibody Raised against Shigella flexneri Serotype 2a
Resolution	1.7 Å
Binding residue (original residue number in PDB)	Y32 W33 R52 P95
Binding residue (residue number reindexed from 1)	Y32 W33 R52 P101

External links

PDB	RCSB:3ggw, PDBe:3ggw, PDBj:3ggw
PDBsum	3ggw
PubMed	19328810

[Back to BioLiP]