Structure of PDB 3fq9 Chain D Binding Site BS01

Receptor Information
>3fq9 Chain D (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>3fq9 Chain C (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AIVEQCCASICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fq9 Design of an insulin analog with enhanced receptor binding selectivity: rationale, structure, and therapeutic implications.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28 T30
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3fq9, PDBe:3fq9, PDBj:3fq9
PDBsum3fq9
PubMed19773552
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]