Structure of PDB 3foe Chain D Binding Site BS01

Receptor Information

>3foe Chain D (length=198) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFILPLRVINTAKAKMADI
LKNEEINTMIYTIGAGVGKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVE
AGHVYIALPPLYKMSKGKGKKEEVAYAWTDGELEELKGATLQRYKGLGEM
DQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDN

Ligand information

>3foe Chain F (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agtcattcatgaccttggt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3foe Structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases
Resolution	4.001 Å
Binding residue (original residue number in PDB)	G434 D435 S436
Binding residue (residue number reindexed from 1)	G18 D19 S20

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3foe, PDBe:3foe, PDBj:3foe
PDBsum	3foe
PubMed	19448616
UniProt	Q59961\|PARE_STRPN DNA topoisomerase 4 subunit B (Gene Name=parE)

[Back to BioLiP]