Structure of PDB 3fma Chain D Binding Site BS01

Receptor Information
>3fma Chain D (length=85) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSVESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETL
GINDIFITLGELMTKLEKYDTDPFTTFDKLHVQTT
Ligand information
>3fma Chain O (length=7) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APPPGLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fma SMY2-type GYF domain recognition in mRNA surveillance complexes
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y20 H28 W39 Y44 F45
Binding residue
(residue number reindexed from 1)		Y9 H17 W28 Y33 F34
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3fma, PDBe:3fma, PDBj:3fma
PDBsum3fma
PubMed
UniProtP32909|SMY2_YEAST Protein SMY2 (Gene Name=SMY2)

[Back to BioLiP]