Structure of PDB 3f27 Chain D Binding Site BS01

Receptor Information
>3f27 Chain D (length=74) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPF
VEEAERLRVQHMQDHPNYKYRPRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3f27 The Structure of Sox17 Bound to DNA Reveals a Conserved Bending Topology but Selective Protein Interaction Platforms
Resolution2.75 Å
Binding residue
(original residue number in PDB)		R70 N73 F75 S99 W106 Y137 R141
Binding residue
(residue number reindexed from 1)		R3 N6 F8 S32 W39 Y70 R74
Binding affinityPDBbind-CN: Kd=2.6nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3f27, PDBe:3f27, PDBj:3f27
PDBsum3f27
PubMed19328208
UniProtQ61473|SOX17_MOUSE Transcription factor SOX-17 (Gene Name=Sox17)

[Back to BioLiP]