Structure of PDB 3eyf Chain D Binding Site BS01

Receptor Information
>3eyf Chain D (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVRLVESGGGVVQPGGSLRLSCEGSGFKFGDHGIHWVRQAPGEGLQWLTV
ISSDGTDERYTDSVKGRFTISRDNSKNTMSLQMNNLRPEDMGLYYCARDG
KCGGGRCYSGLLDYWGQGTMVTVSSASFKGPSVFPLATAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSQTYICNVNHK
PSNTKVDKKVE
Ligand information
>3eyf Chain F (length=9) Species: 10363 (Human herpesvirus 5 strain Towne) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TIYNTTLKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3eyf Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S52 D54 D57 G100 K101 C102 R106 C107 Y108 S109 L111
Binding residue
(residue number reindexed from 1)		S52 D54 D57 G100 K101 C102 R106 C107 Y108 S109 L111
Enzymatic activity
Enzyme Commision number ?
External links