Structure of PDB 3eh8 Chain D Binding Site BS01

Receptor Information
>3eh8 Chain D (length=254) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDLTYAYLVGLYEGDGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKI
LGIGIVSFRKRNEIEMVALRIRDKNHLKSKILPIFEKYPMFSNKQYDYLR
FRNALLSGIIYLEDLPDYTRSDEPLNSIESIINTSYFSAWLVGFIEAEGC
FSVYKLNKDDDYLIASFDIAQRDGDILISAIRKYLSFTTKVYLDKTNCSK
LKVTSVRSVENIIKFLQNAPVKLLGNKKLQYKLWLKQLRKISRYSEKIKI
PSNY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3eh8 Optimization of in vivo activity of a bifunctional homing endonuclease and maturase reverses evolutionary degradation.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K24 Y27 I55 R59 R61 R70 R72 D73 K74 I110 Y111 E148 C150 S152 Y154 K158 D168 Q171 R172 K200 K202 Q230
Binding residue
(residue number reindexed from 1)		K24 Y27 I55 R59 R61 R70 R72 D73 K74 I110 Y111 E148 C150 S152 Y154 K158 D168 Q171 R172 K200 K202 Q230
Binding affinityPDBbind-CN: Kd=12nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:3eh8, PDBe:3eh8, PDBj:3eh8
PDBsum3eh8
PubMed19103658
UniProtP03880|ANI1_EMEND Intron-encoded DNA endonuclease I-AniI (Gene Name=I-AniI)

[Back to BioLiP]