Structure of PDB 3e2u Chain D Binding Site BS01

Receptor Information
>3e2u Chain D (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQG
RKYFTCDEGHGIFVRQSQIQVFED
Ligand information
>3e2u Chain E (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPYCEICEMFGHWATNCNDDETF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e2u Structure-function relationship of CAP-Gly domains
Resolution2.6 Å
Binding residue
(original residue number in PDB)		I36 K38 Q95
Binding residue
(residue number reindexed from 1)		I11 K13 Q70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3e2u, PDBe:3e2u, PDBj:3e2u
PDBsum3e2u
PubMed17828277
UniProtQ14203|DCTN1_HUMAN Dynactin subunit 1 (Gene Name=DCTN1)

[Back to BioLiP]