Structure of PDB 3d87 Chain D Binding Site BS01

Receptor Information

>3d87 Chain D (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSG
KTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE
PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA
ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEQ
YTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLT
FCVQVDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPC

Ligand information

Ligand ID

MAN

InChI

InChI=1S/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5+,6+/m1/s1

InChIKey

WQZGKKKJIJFFOK-PQMKYFCFSA-N

SMILES

Software	SMILES
OpenEye OEToolkits 1.5.0	C(C1C(C(C(C(O1)O)O)O)O)O
CACTVS 3.341	OC[CH]1O[CH](O)[CH](O)[CH](O)[CH]1O
CACTVS 3.341	OC[C@H]1O[C@H](O)[C@@H](O)[C@@H](O)[C@@H]1O
OpenEye OEToolkits 1.5.0	C([C@@H]1[C@H]([C@@H]([C@@H]([C@H](O1)O)O)O)O)O
ACDLabs 10.04	OC1C(O)C(OC(O)C1O)CO

Formula

C6 H12 O6

Name

alpha-D-mannopyranose;
alpha-D-mannose;
D-mannose;
mannose

PDB chain

3d87 Chain D Residue 1281 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3d87 Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody
Resolution	2.9 Å
Binding residue (original residue number in PDB)	R279 N281 A282
Binding residue (residue number reindexed from 1)	R270 N272 A273
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004896	cytokine receptor activity
GO:0005125	cytokine activity
GO:0005126	cytokine receptor binding
GO:0005143	interleukin-12 receptor binding
GO:0005515	protein binding
GO:0008083	growth factor activity
GO:0019955	cytokine binding
GO:0042164	interleukin-12 alpha subunit binding
GO:0042802	identical protein binding
GO:0044877	protein-containing complex binding
GO:0045519	interleukin-23 receptor binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0001817	regulation of cytokine production
GO:0001916	positive regulation of T cell mediated cytotoxicity
GO:0002230	positive regulation of defense response to virus by host
GO:0002323	natural killer cell activation involved in immune response
GO:0002827	positive regulation of T-helper 1 type immune response
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
GO:0002862	negative regulation of inflammatory response to antigenic stimulus
GO:0007166	cell surface receptor signaling pathway
GO:0007259	cell surface receptor signaling pathway via JAK-STAT
GO:0008283	cell population proliferation
GO:0010224	response to UV-B
GO:0016477	cell migration
GO:0019221	cytokine-mediated signaling pathway
GO:0019953	sexual reproduction
GO:0030101	natural killer cell activation
GO:0032693	negative regulation of interleukin-10 production
GO:0032700	negative regulation of interleukin-17 production
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032729	positive regulation of type II interferon production
GO:0032733	positive regulation of interleukin-10 production
GO:0032735	positive regulation of interleukin-12 production
GO:0032740	positive regulation of interleukin-17 production
GO:0032760	positive regulation of tumor necrosis factor production
GO:0032816	positive regulation of natural killer cell activation
GO:0032819	positive regulation of natural killer cell proliferation
GO:0032946	positive regulation of mononuclear cell proliferation
GO:0034105	positive regulation of tissue remodeling
GO:0034393	positive regulation of smooth muscle cell apoptotic process
GO:0035722	interleukin-12-mediated signaling pathway
GO:0042088	T-helper 1 type immune response
GO:0042093	T-helper cell differentiation
GO:0042098	T cell proliferation
GO:0042102	positive regulation of T cell proliferation
GO:0042104	positive regulation of activated T cell proliferation
GO:0042832	defense response to protozoan
GO:0043382	positive regulation of memory T cell differentiation
GO:0045672	positive regulation of osteoclast differentiation
GO:0045785	positive regulation of cell adhesion
GO:0048662	negative regulation of smooth muscle cell proliferation
GO:0050671	positive regulation of lymphocyte proliferation
GO:0050709	negative regulation of protein secretion
GO:0050729	positive regulation of inflammatory response
GO:0050829	defense response to Gram-negative bacterium
GO:0051135	positive regulation of NK T cell activation
GO:0051142	positive regulation of NK T cell proliferation
GO:0051607	defense response to virus
GO:0071222	cellular response to lipopolysaccharide
GO:0071346	cellular response to type II interferon
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway
GO:1901224	positive regulation of non-canonical NF-kappaB signal transduction
GO:1903588	negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:2000318	positive regulation of T-helper 17 type immune response
GO:2000330	positive regulation of T-helper 17 cell lineage commitment

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005788	endoplasmic reticulum lumen
GO:0005829	cytosol
GO:0009897	external side of plasma membrane
GO:0009986	cell surface
GO:0016020	membrane
GO:0031906	late endosome lumen
GO:0043235	receptor complex
GO:0043514	interleukin-12 complex
GO:0070743	interleukin-23 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3d87, PDBe:3d87, PDBj:3d87
PDBsum	3d87
PubMed	18708069
UniProt	P29460\|IL12B_HUMAN Interleukin-12 subunit beta (Gene Name=IL12B)

[Back to BioLiP]