Structure of PDB 3bvn Chain D Binding Site BS01

Receptor Information
>3bvn Chain D (length=277) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP
WIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQWMYG
CDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
REAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEPS
Ligand information
>3bvn Chain F (length=9) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRRWRRLTV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bvn Structural basis for T cell alloreactivity among three HLA-B14 and HLA-B27 antigens
Resolution2.55 Å
Binding residue
(original residue number in PDB)		Y7 Y9 S24 E45 N63 C67 D74 S77 N80 Y84 W97 Y99 F116 T143 W147 A150 E152 Y159 T163 W167
Binding residue
(residue number reindexed from 1)		Y7 Y9 S24 E45 N63 C67 D74 S77 N80 Y84 W97 Y99 F116 T143 W147 A150 E152 Y159 T163 W167
Enzymatic activity
Enzyme Commision number ?
External links