Structure of PDB 3bew Chain D Binding Site BS01

Receptor Information
>3bew Chain D (length=271) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWI
AANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCD
ILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYA
EGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCR
AHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDG
DKYQCRVEHASLPQPGLYSWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bew Structures of an MHC class I molecule from b21 chickens illustrate promiscuous Peptide binding
Resolution2.6 Å
Binding residue
(original residue number in PDB)
Y7 R9 D24 R61 E62 I65 V66 S69 I72 N76 L80 W95 H111 F120 T140 Y149 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)
Y7 R9 D24 R61 E62 I65 V66 S69 I72 N76 L80 W95 H111 F120 T140 Y149 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links