Structure of PDB 3auw Chain D Binding Site BS01

Receptor Information

>3auw Chain D (length=175) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEE
LEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDY
NSFHETYETSTPSLSAKELAELANR

Ligand information

>3auw Chain C (length=17) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

IQRYVRKDGKCNVHHGN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3auw Inverse agonist-like action of cadmium on G-protein-gated inward-rectifier K(+) channels
Resolution	3.56 Å
Binding residue (original residue number in PDB)	R230 F274 V276 F348 Y349 V351 Y353
Binding residue (residue number reindexed from 1)	R27 F71 V73 F145 Y146 V148 Y150

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005242	inward rectifier potassium channel activity

	Biological Process
GO:0006813	potassium ion transport

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3auw, PDBe:3auw, PDBj:3auw
PDBsum	3auw
PubMed	21396912
UniProt	P48542\|KCNJ6_MOUSE G protein-activated inward rectifier potassium channel 2 (Gene Name=Kcnj6)

[Back to BioLiP]