Structure of PDB 2z31 Chain D Binding Site BS01

Receptor Information

>2z31 Chain D (length=188) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVT
ELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVIS
LSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGD
WTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA

Ligand information

>2z31 Chain P (length=11) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RGGASQYRPSQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2z31 Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
Resolution	2.7 Å
Binding residue (original residue number in PDB)	F11 P13 Y26 Y30 Y60 Y61 Y67 E74 V78 Y81 N82
Binding residue (residue number reindexed from 1)	F10 P12 Y25 Y29 Y59 Y60 Y64 E71 V75 Y78 N79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2z31, PDBe:2z31, PDBj:2z31
PDBsum	2z31
PubMed	17694060
UniProt	P06344\|HB2U_MOUSE H-2 class II histocompatibility antigen, A-U beta chain

[Back to BioLiP]