Structure of PDB 2ypl Chain D Binding Site BS01

Receptor Information
>2ypl Chain D (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFS
NMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAVSGGYQKVTFG
IGTKLQVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
>2ypl Chain C (length=11) Species: 12721 (Human immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KAFSPEVIPMF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ypl Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y31 Y33 S92 G93 G94 Y95 Q96
Binding residue
(residue number reindexed from 1)		Y30 Y32 S91 G92 G93 Y94 Q95
External links