Structure of PDB 2xjz Chain D Binding Site BS01

Receptor Information
>2xjz Chain D (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKL
GRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAAC
QKHFCVGDRYLLINSDIVCEQDIYEWTKI
Ligand information
>2xjz Chain K (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVMVVGEPTLMGGEFGDEDER
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xjz Structure of the Leukemia Oncogene Lmo2: Implications for the Assembly of a Hematopoietic Transcription Factor Complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L68 L80 F81
Binding residue
(residue number reindexed from 1)		L50 L62 F63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2xjz, PDBe:2xjz, PDBj:2xjz
PDBsum2xjz
PubMed21076045
UniProtP25791|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)

[Back to BioLiP]