Structure of PDB 2wv5 Chain D Binding Site BS01

Receptor Information
>2wv5 Chain D (length=200) Species: 12112 (Foot-and-mouth disease virus (strain A10-61)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLQKMVMGNTKPVELILDGKTVAICCATGVFGTAYLVPRHLFAEKYDKIM
LDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHRGNKVRDITKHFRDT
ARMKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVLMDGDTMPGLFAYKA
ATRAGYAGGAVLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLQKMKAHV
Ligand information
>2wv5 Chain H (length=9) Species: 12112 (Foot-and-mouth disease virus (strain A10-61)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APAKELLNF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wv5 Insights Into Cleavage Specificity from the Crystal Structure of Foot-and-Mouth Disease Virus 3C Protease Complexed with a Peptide Substrate.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
V28 A29 I30 H46 E50 L142 M143 D144 D146 T158 R159 A160 G161 A163 H181 S182 A183 G184 N186 Y190
Binding residue
(residue number reindexed from 1)
V22 A23 I24 H40 E44 L136 M137 D138 D140 T152 R153 A154 G155 A157 H175 S176 A177 G178 N180 Y184
Enzymatic activity
Catalytic site (original residue number in PDB) H46 D84 A163 S182
Catalytic site (residue number reindexed from 1) H40 D78 A157 S176
Enzyme Commision number 2.7.7.48: RNA-directed RNA polymerase.
3.4.22.28: picornain 3C.
3.4.22.46: L-peptidase.
3.6.1.15: nucleoside-triphosphate phosphatase.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2wv5, PDBe:2wv5, PDBj:2wv5
PDBsum2wv5
PubMed19883658
UniProtP03306|POLG_FMDV1 Genome polyprotein

[Back to BioLiP]