Structure of PDB 2wfy Chain D Binding Site BS01

Receptor Information

>2wfy Chain D (length=260) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVG
EEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYP
PEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ
QPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSW
PESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVS
LLNPPETLNL

Ligand information

>2wfy Chain F (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRPF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2wfy Truncation and Optimisation of Peptide Inhibitors of Cyclin-Dependent Kinase 2-Cyclin a Through Structure-Guided Design.
Resolution	2.53 Å
Binding residue (original residue number in PDB)	M210 I213 E220 Q254 I281 T282 T285
Binding residue (residue number reindexed from 1)	M38 I41 E48 Q82 I109 T110 T113

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity

	Biological Process
GO:0044772	mitotic cell cycle phase transition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2wfy, PDBe:2wfy, PDBj:2wfy
PDBsum	2wfy
PubMed	19472269
UniProt	P20248\|CCNA2_HUMAN Cyclin-A2 (Gene Name=CCNA2)

[Back to BioLiP]