Structure of PDB 2ve9 Chain D Binding Site BS01

Receptor Information
>2ve9 Chain D (length=62) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMN
TNGSREVIAPAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ve9 Molecular Mechanism of Sequence-Directed DNA Loading and Translocation by Ftsk.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
K773 I774 G775 R778 R781
Binding residue
(residue number reindexed from 1)
K27 I28 G29 R32 R35
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ve9, PDBe:2ve9, PDBj:2ve9
PDBsum2ve9
PubMed18722176
UniProtQ9I0M3|FTSK_PSEAE DNA translocase FtsK (Gene Name=ftsK)

[Back to BioLiP]