Structure of PDB 2ql7 Chain D Binding Site BS01

Receptor Information
>2ql7 Chain D (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQI
LTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ql7 Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y530 S531 W532 R533 P535 W540
Binding residue
(residue number reindexed from 1)		Y19 S20 W21 R22 P24 W29
Enzymatic activity
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ql7, PDBe:2ql7, PDBj:2ql7
PDBsum2ql7
PubMed17697120
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]