Structure of PDB 2p5w Chain D Binding Site BS01

Receptor Information
>2p5w Chain D (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQQVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLI
TPWQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGTY
IPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQ
SKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2p5w Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
Resolution2.2 Å
Binding residue
(original residue number in PDB)
Y31 P94 L95 L96 G98 Y100
Binding residue
(residue number reindexed from 1)
Y31 P94 L95 L96 G98 Y100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2p5w, PDBe:2p5w, PDBj:2p5w
PDBsum2p5w
PubMed17644531
UniProtP01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]