Structure of PDB 2p5e Chain D Binding Site BS01

Receptor Information
>2p5e Chain D (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLL
ITPWQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGT
YIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVS
QSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2p5e Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
Resolution1.89 Å
Binding residue
(original residue number in PDB)
Y31 P94 L95 L96 D97 G98 Y100
Binding residue
(residue number reindexed from 1)
Y32 P95 L96 L97 D98 G99 Y101
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2p5e, PDBe:2p5e, PDBj:2p5e
PDBsum2p5e
PubMed17644531
UniProtP01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]