Structure of PDB 2otw Chain D Binding Site BS01

Receptor Information
>2otw Chain D (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQPGGSLKLSCAASGFTFRDYYMYWVRQTPEKRLEWVAF
ISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARGR
GYVWFAYWGQGTTVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2otw Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
Resolution2.35 Å
Binding residue
(original residue number in PDB)		D31 Y32 Y33 Y35 G99 R100 G101 Y102 V103
Binding residue
(residue number reindexed from 1)		D31 Y32 Y33 Y35 G99 R100 G101 Y102 V103
External links