Structure of PDB 2ns8 Chain D Binding Site BS01

Receptor Information
>2ns8 Chain D (length=198) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL
DALAIEMLDRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHRDGAKVHLG
TRPTEKQYETLENQLAFLTQQGFSLENALYALSAVGHFTLGSVLEDQEHQ
VAKEERETDSMPPLLRQAIELFDHQGAEPAFLHGLESLIRGFEVQLTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ns8 How an agonist peptide mimics the antibiotic tetracycline to induce Tet-repressor
Resolution2.55 Å
Binding residue
(original residue number in PDB)
E147 D148 H151 Q152 K155 E156 E159 T160 I174 F177 G181 A182
Binding residue
(residue number reindexed from 1)
E145 D146 H149 Q150 K153 E154 E157 T158 I169 F172 G176 A177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2ns8, PDBe:2ns8, PDBj:2ns8
PDBsum2ns8
PubMed17374541
UniProtP04483|TETR2_ECOLX Tetracycline repressor protein class B from transposon Tn10 (Gene Name=tetR)

[Back to BioLiP]