Structure of PDB 2heo Chain D Binding Site BS01

Receptor Information
>2heo Chain D (length=58) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNLEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSP
SPKYWSIG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2heo Structure-based secondary structure-independent approach to design protein ligands: Application to the design of Kv1.2 potassium channel blockers.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		K143 N146 Q147 Y150 K164
Binding residue
(residue number reindexed from 1)		K32 N35 Q36 Y39 K53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity
Biological Process
GO:0060340 positive regulation of type I interferon-mediated signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2heo, PDBe:2heo, PDBj:2heo
PDBsum2heo
PubMed17165772
UniProtQ9QY24|ZBP1_MOUSE Z-DNA-binding protein 1 (Gene Name=Zbp1)

[Back to BioLiP]