Structure of PDB 2h27 Chain D Binding Site BS01

Receptor Information
>2h27 Chain D (length=69) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVR
SRIFRAREAIDNKVQPLIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h27 The structural basis for promoter -35 element recognition by the group IV sigma factors.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		P139 P166 G168 T169 S172 R173 R176
Binding residue
(residue number reindexed from 1)		P18 P45 G47 T48 S51 R52 R55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2h27, PDBe:2h27, PDBj:2h27
PDBsum2h27
PubMed16903784
UniProtP0AGB6|RPOE_ECOLI ECF RNA polymerase sigma-E factor (Gene Name=rpoE)

[Back to BioLiP]