Structure of PDB 2h0r Chain D Binding Site BS01

Receptor Information

>2h0r Chain D (length=216) Species: 4932 (Saccharomyces cerevisiae)

MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTR
DWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTW
GSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLE
KHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVIN
KVKEELKAHNINVVDK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2h0r Chain D Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2h0r Crystal structure of the yeast nicotinamidase Pnc1p.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): D51 H53 H94
• Binding residue (residue number reindexed from 1): D51 H53 H94
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): D8 D51 H53 S59 H94 K122 E129 A163 C167
• Catalytic site (residue number reindexed from 1): D8 D51 H53 S59 H94 K122 E129 A163 C167
• Enzyme Commision number: 3.5.1.19: nicotinamidase.

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0008936 nicotinamidase activity
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000183 rDNA heterochromatin formation
• GO:0019358 nicotinate nucleotide salvage
• GO:0019363 pyridine nucleotide biosynthetic process
• GO:0031509 subtelomeric heterochromatin formation
• GO:1904524 negative regulation of DNA amplification

Cellular Component

• GO:0000781 chromosome, telomeric region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005777 peroxisome

External links

• PDB: RCSB:2h0r, PDBe:2h0r, PDBj:2h0r
• PDBsum: 2h0r
• PubMed: 17382284
• UniProt: P53184|PNC1_YEAST Nicotinamidase (Gene Name=PNC1)