Structure of PDB 2gsi Chain D Binding Site BS01

Receptor Information
>2gsi Chain D (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQQSGAELVRSGASVKLSCTASGFNIKDYYMYWVKLRPEQGLEWIGWI
DPENGDTEYVPTFQGKVTMTADTSSNTAYLQLSSLTSEDTAVYYCNAGVI
TMQAMDYWGQGTTVTTSSAKTTPPSVYPLAPGTAASMVTLGCLVKGYFPE
PVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVA
HPASSTKVDKKIVPR
Ligand information
>2gsi Chain X (length=11) Species: 1280 (Staphylococcus aureus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TKHPKKGVEKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gsi Crystal Structure of a Murine Fab in Complex with an 11 Residue Peptide Derived from Staphylococcal Nuclease
Resolution2.81 Å
Binding residue
(original residue number in PDB)
D31 Y32 Y33 Y35 W50 D52 V96 I97 T98 M99
Binding residue
(residue number reindexed from 1)
D30 Y31 Y32 Y34 W49 D51 V99 I100 T101 M102
Enzymatic activity
Enzyme Commision number ?
External links