Structure of PDB 2gje Chain D Binding Site BS01

Receptor Information
>2gje Chain D (length=147) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSLPKFEIHDVRDDPAEGTMTRVAVDGKLLLISQYPQLGPRKVDPNDLSP
QFDADRRISVRLRHVDLAYLVGVCKERVPRHRMETKAYTLDFEKSAQGYH
LHGKVHRVASQRMEDWSVKFDNHFAVTLEHFLESALDESFGFRQHYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gje Crystal Structures of T. brucei MRP1/MRP2 Guide-RNA Binding Complex Reveal RNA Matchmaking Mechanism.
Resolution3.37 Å
Binding residue
(original residue number in PDB)		Y61 A80 R83
Binding residue
(residue number reindexed from 1)		Y35 A54 R57
Binding affinityPDBbind-CN: Kd=7nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010608 post-transcriptional regulation of gene expression
GO:0016556 mRNA modification
Cellular Component
GO:0005739 mitochondrion
GO:0031019 mitochondrial mRNA editing complex
GO:0031981 nuclear lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gje, PDBe:2gje, PDBj:2gje
PDBsum2gje
PubMed16923390
UniProtP90629

[Back to BioLiP]