Structure of PDB 2f53 Chain D Binding Site BS01

Receptor Information
>2f53 Chain D (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLL
IPFWQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPTSGGS
YIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVS
QSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2f53 Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Y30 P93 T94 S95 G97 Y99
Binding residue
(residue number reindexed from 1)
Y32 P95 T96 S97 G99 Y101
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2f53, PDBe:2f53, PDBj:2f53
PDBsum2f53
PubMed16600963
UniProtP01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]