Structure of PDB 2d45 Chain D Binding Site BS01

Receptor Information
>2d45 Chain D (length=115) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKG
FIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKE
DLSQDEIEELRNILN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d45 Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R46 F67
Binding residue
(residue number reindexed from 1)		R40 F61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2d45, PDBe:2d45, PDBj:2d45
PDBsum2d45
PubMed16582476
UniProtP68261|MECI_STAAN Methicillin resistance regulatory protein MecI (Gene Name=mecI)

[Back to BioLiP]