Structure of PDB 2d1x Chain D Binding Site BS01

Receptor Information
>2d1x Chain D (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLF
PANYVELRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d1x Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y12 G39 W40 N55 Y56
Binding residue
(residue number reindexed from 1)		Y10 G37 W38 N53 Y54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2d1x, PDBe:2d1x, PDBj:2d1x
PDBsum2d1x
PubMed16636290
UniProtQ14247|SRC8_HUMAN Src substrate cortactin (Gene Name=CTTN)

[Back to BioLiP]