Structure of PDB 2cax Chain D Binding Site BS01

Receptor Information
>2cax Chain D (length=47) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2cax Structures of Omega Repressors Bound to Direct and Inverted DNA Repeats Explain Modulation of Transcription.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
K28 T29 R31
Binding residue
(residue number reindexed from 1)
K4 T5 R7
Binding affinityPDBbind-CN: Kd=40nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:2cax, PDBe:2cax, PDBj:2cax
PDBsum2cax
PubMed16528102
UniProtQ57468

[Back to BioLiP]