Structure of PDB 2atp Chain D Binding Site BS01

Receptor Information
>2atp Chain D (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIQTPSSLLVQTNHTAKMSCEVKSISSIYWLRERQDPKDKYFEFLASWSS
SKGVLYGESVDKKRNIILESSDSRRPFLSIMNVKPEDSDFYFCATVGSPK
MVFGTGTKLTVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2atp Structural and Mutational Analyses of a CD8alphabeta Heterodimer and Comparison with the CD8alphaalpha Homodimer.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		L1 K23 F106
Binding residue
(residue number reindexed from 1)		L1 K23 F103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0015026 coreceptor activity
GO:0042288 MHC class I protein binding
Biological Process
GO:0050776 regulation of immune response

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2atp, PDBe:2atp, PDBj:2atp
PDBsum2atp
PubMed16356863
UniProtP10300|CD8B_MOUSE T-cell surface glycoprotein CD8 beta chain (Gene Name=Cd8b)

[Back to BioLiP]