Structure of PDB 2acj Chain D Binding Site BS01

Receptor Information
>2acj Chain D (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQ
KEAGTPPLWKIAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2acj Crystal structure of a junction between B-DNA and Z-DNA reveals two extruded bases.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K169 K170 N173 R174 Y177 G190 T191 P193
Binding residue
(residue number reindexed from 1)		K33 K34 N37 R38 Y41 G54 T55 P57
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:2acj, PDBe:2acj, PDBj:2acj
PDBsum2acj
PubMed16237447
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]