Structure of PDB 1zme Chain D Binding Site BS01

Receptor Information
>1zme Chain D (length=70) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQ
KDLNDKTEENNRLKALLLER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zme Crystal structure of a PUT3-DNA complex reveals a novel mechanism for DNA recognition by a protein containing a Zn2Cys6 binuclear cluster.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S31 V32 R38 H41 K43 P65 S66 K67 K68 V70
Binding residue
(residue number reindexed from 1)		S1 V2 R8 H11 K13 P35 S36 K37 K38 V40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zme, PDBe:1zme, PDBj:1zme
PDBsum1zme
PubMed9303004
UniProtP25502|PUT3_YEAST Proline utilization trans-activator (Gene Name=PUT3)

[Back to BioLiP]