Structure of PDB 1zbh Chain D Binding Site BS01

Receptor Information
>1zbh Chain D (length=289) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNY
YKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLL
NTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKK
VIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWIN
IRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPNCGLDDSKNIARIAVRM
LQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zbh Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
Resolution3.0 Å
Binding residue
(original residue number in PDB)		F61 Y66 K67 A70 N73 G74 N77 R78 K104 K107 K111
Binding residue
(residue number reindexed from 1)		F2 Y7 K8 A11 N14 G15 N18 R19 K45 K48 K52
Enzymatic activity
Catalytic site (original residue number in PDB) D134 E136 D234 N293 D298
Catalytic site (residue number reindexed from 1) D75 E77 D175 N234 D239
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:1zbh, PDBe:1zbh, PDBj:1zbh
PDBsum1zbh
PubMed
UniProtQ8IV48|ERI1_HUMAN 3'-5' exoribonuclease 1 (Gene Name=ERI1)

[Back to BioLiP]