Structure of PDB 1ymm Chain D Binding Site BS01

Receptor Information
>1ymm Chain D (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHS
GRLRVTLDTSKKSSSLLITASRAADTASYFCATDTTSGTYKYIFGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ymm Unconventional topology of self peptide-major histocompatibility complex binding by a human autoimmune T cell receptor.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
G96 Y98
Binding residue
(residue number reindexed from 1)
G88 Y90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ymm, PDBe:1ymm, PDBj:1ymm
PDBsum1ymm
PubMed15821740
UniProtP01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]