Structure of PDB 1xw7 Chain D Binding Site BS01

Receptor Information
>1xw7 Chain D (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1xw7 Chain C (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GILEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xw7 Diabetes-associated mutations in human insulin: crystal structure and photo-cross-linking studies of a-chain variant insulin wakayama
Resolution2.3 Å
Binding residue
(original residue number in PDB)		C7 L11 L15 C19 R22 G23 F24 F25
Binding residue
(residue number reindexed from 1)		C7 L11 L15 C19 R22 G23 F24 F25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1xw7, PDBe:1xw7, PDBj:1xw7
PDBsum1xw7
PubMed15794638
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]