Structure of PDB 1xv9 Chain D Binding Site BS01

Receptor Information
>1xv9 Chain D (length=246) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLA
PVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEIC
HIVLNTTFCLQTQNFLCGPLRYTIEDGARVGFQVEFLELLFHFHGTLRKL
QLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRR
PRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xv9 A Structural Basis for Constitutive Activity in the Human CAR/RXRalpha Heterodimer.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K177 R183 E345 S348
Binding residue
(residue number reindexed from 1)		K75 R81 E243 S246
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1xv9, PDBe:1xv9, PDBj:1xv9
PDBsum1xv9
PubMed15610735
UniProtQ14994|NR1I3_HUMAN Nuclear receptor subfamily 1 group I member 3 (Gene Name=NR1I3)

[Back to BioLiP]