Structure of PDB 1xhv Chain D Binding Site BS01

Receptor Information
>1xhv Chain D (length=247) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIGQKVKRAAGEPFEKLVYKFLKENLSDLTFKQYEYL
NDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQN
DTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKE
FDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQF
HVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xhv Mechanistic Insights from the Structures of HincII Bound to Cognate DNA Cleaved from Addition of Mg(2+) and Mn(2+)
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q109 N110 I143 S144 Y146 K147 A205 Q207
Binding residue
(residue number reindexed from 1)		Q99 N100 I133 S134 Y136 K137 A195 Q197
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1xhv, PDBe:1xhv, PDBj:1xhv
PDBsum1xhv
PubMed15476804
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]