Structure of PDB 1xb1 Chain D Binding Site BS01

Receptor Information
>1xb1 Chain D (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCG
GGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xb1 The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition
Resolution2.7 Å
Binding residue
(original residue number in PDB)
K297 G306 L307 A308 W310 E314 Q319 W323 Y324
Binding residue
(residue number reindexed from 1)
K43 G52 L53 A54 W56 E60 Q65 W69 Y70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1xb1, PDBe:1xb1, PDBj:1xb1
PDBsum1xb1
PubMed15485395
UniProtQ96P09|BIRC8_HUMAN Baculoviral IAP repeat-containing protein 8 (Gene Name=BIRC8)

[Back to BioLiP]