Structure of PDB 1w72 Chain D Binding Site BS01

Receptor Information
>1w72 Chain D (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAP
WIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYG
CDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAV
HAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1w72 A Major Histocompatibility Complex.Peptide- Restricted Antibody and T Cell Receptor Molecules Recognize Their Target by Distinct Binding Modes: Crystal Structure of Human Leukocyte Antigen (Hla)-A1.Mage-A1 in Complex with Fab-Hyb3
Resolution2.15 Å
Binding residue
(original residue number in PDB)
M5 Y7 E63 N66 N77 L81 Y84 Y99 D116 Y123 T143 K146 W147 A152 Q155 R156 Y159 R163 Y171
Binding residue
(residue number reindexed from 1)
M5 Y7 E63 N66 N77 L81 Y84 Y99 D116 Y123 T143 K146 W147 A152 Q155 R156 Y159 R163 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1w72, PDBe:1w72, PDBj:1w72
PDBsum1w72
PubMed15537658
UniProtP04439|HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain (Gene Name=HLA-A)

[Back to BioLiP]