Structure of PDB 1vwl Chain D Binding Site BS01

Receptor Information
>1vwl Chain D (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vwl In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		S45 Y54 W79 S88 T90 W108
Binding residue
(residue number reindexed from 1)		S33 Y42 W67 S76 T78 W96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1vwl, PDBe:1vwl, PDBj:1vwl
PDBsum1vwl
PubMed9148939
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]