Structure of PDB 1t2k Chain D Binding Site BS01

Receptor Information
>1t2k Chain D (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRN
EVAQLKQLLLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t2k Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R343 R350 S351 K354
Binding residue
(residue number reindexed from 1)		R8 R15 S16 K19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1t2k, PDBe:1t2k, PDBj:1t2k
PDBsum1t2k
PubMed15510218
UniProtP15336|ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 (Gene Name=ATF2)

[Back to BioLiP]