Structure of PDB 1t0n Chain D Binding Site BS01

Receptor Information
>1t0n Chain D (length=278) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRAR
WMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISG
CEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQA
GEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVT
LRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVP
LGKEQYYTCHVYHQGLPEPLTLRWEPPP
Ligand information
>1t0n Chain Q (length=8) Species: 10304 (Human alphaherpesvirus 1 strain F) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSIEFARL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t0n The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 N70 S73 F74 D77 Y84 Q114 Y116 T143 K146 W147 E152 R155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 N70 S73 F74 D77 Y84 Q114 Y116 T143 K146 W147 E152 R155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1t0n, PDBe:1t0n, PDBj:1t0n
PDBsum1t0n
PubMed15210799
UniProtP01901|HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain (Gene Name=H2-K1)

[Back to BioLiP]