Structure of PDB 1sts Chain D Binding Site BS01

Receptor Information
>1sts Chain D (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sts Topochemical catalysis achieved by structure-based ligand design.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		L25 S27 S45 Y54 W79 T90
Binding residue
(residue number reindexed from 1)		L13 S15 S33 Y42 W67 T78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1sts, PDBe:1sts, PDBj:1sts
PDBsum1sts
PubMed8537386
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]