Structure of PDB 1r5w Chain D Binding Site BS01

Receptor Information
>1r5w Chain D (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTEL
GRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYP
TKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDW
TFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r5w Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation
Resolution2.9 Å
Binding residue
(original residue number in PDB)		E36 S40 N87 W88 V105 N109 I112
Binding residue
(residue number reindexed from 1)		E6 S10 N57 W58 V75 N79 I82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1r5w, PDBe:1r5w, PDBj:1r5w
PDBsum1r5w
PubMed14690592
UniProtQ31164

[Back to BioLiP]