Structure of PDB 1r5v Chain D Binding Site BS01

Receptor Information

>1r5v Chain D (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTEL
GRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYP
TKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDW
TFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW

Ligand information

>1r5v Chain F (length=13) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ADLIAYPKAATKF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1r5v Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	E36 S40 D84 N87 W88 E101 H108 N109 I112 F113
Binding residue (residue number reindexed from 1)	E6 S10 D54 N57 W58 E71 H78 N79 I82 F83

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1r5v, PDBe:1r5v, PDBj:1r5v
PDBsum	1r5v
PubMed	14690592
UniProt	P18468\|HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain (Gene Name=H2-Eb1)

[Back to BioLiP]